Lineage for d6hgbd_ (6hgb D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. Protein Influenza neuraminidase [50943] (9 species)
  7. Species Influenza a virus (strain a/duck/england/1/1956 h11n6) [TaxId:383550] [356823] (3 PDB entries)
  8. Domain d6hgbd_: 6hgb D: [357172]
    automated match to d1v0za_
    complexed with ca, gol, nag, peg, po4

Details for d6hgbd_

PDB Entry: 6hgb (more details), 1.5 Å

PDB Description: influenza a virus n6 neuraminidase native structure (duck/england/56).
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d6hgbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgbd_ b.68.1.1 (D:) Influenza neuraminidase {Influenza a virus (strain a/duck/england/1/1956 h11n6) [TaxId: 383550]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d6hgbd_ are not available.

Timeline for d6hgbd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6hgba_, d6hgbb_, d6hgbc_