Lineage for d1ewvb_ (1ewv B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143883Protein Metabotropic glutamate receptor subtype 1 [53847] (1 species)
  7. 2143884Species Norway rat (Rattus norvegicus) [TaxId:10116] [53848] (5 PDB entries)
  8. 2143893Domain d1ewvb_: 1ewv B: [35717]

Details for d1ewvb_

PDB Entry: 1ewv (more details), 4 Å

PDB Description: crystal structure of metabotropic glutamate receptor subtype 1 ligand free form ii
PDB Compounds: (B:) metabotropic glutamate receptor subtype 1

SCOPe Domain Sequences for d1ewvb_:

Sequence, based on SEQRES records: (download)

>d1ewvb_ c.93.1.1 (B:) Metabotropic glutamate receptor subtype 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpvl
lpnitlgseirdscwhssvaleqsiefirdslisirdekdglnrclpdgqtlppgrtkkp
iagvigpgsssvaiqvqnllqlfdipqiaysatsidlsdktlykyflrvvpsdtlqaram
ldivkrynwtyvsavhtegnygesgmdafkelaaqeglciahsdkiysnageksfdrllr
klrerlpkarvvvcfcegmtvrgllsamrrlgvvgefsligsdgwadrdeviegyevean
ggitiklqspevrsfddyflklrldtntrnpwfpefwqhrfqcrlpghllenpnfkkvct
gnesleenyvqdskmgfvinaiyamahglqnmhhalcpghvglcdamkpidgrklldfli
kssfvgvsgeevwfdekgdapgrydimnlqyteanrydyvhvgtwhegvlniddyki

Sequence, based on observed residues (ATOM records): (download)

>d1ewvb_ c.93.1.1 (B:) Metabotropic glutamate receptor subtype 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rsvarmdgdviigalfsvhhqppaekvperkcgeireqygiqrveamfhtldkinadpvl
lpnitlgseirdscwhssvaleqsiefirkpiagvigpgsssvaiqvqnllqlfdipqia
ysatsidlsdktlykyflrvvpsdtlqaramldivkrynwtyvsavhtegnygesgmdaf
kelaaqeglciahsdkiysnageksfdrllrklrerlpkarvvvcfcegmtvrgllsamr
rlgvvgefsligsdgwadrdeviegyeveanggitiklqspevrsfddyflklrldtntr
npwfpefwqhrfqcrlpghllenpnfkkvctgnesleenyvqdskmgfvinaiyamahgl
qnmhhalcpghvglcdamkpidgrklldflikssfvgvsgeevwfdekgdapgrydimnl
qyteanrydyvhvgtwhegvlniddyki

SCOPe Domain Coordinates for d1ewvb_:

Click to download the PDB-style file with coordinates for d1ewvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ewvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ewva_