SCOPe 2.08: Domain d5z1xb3: 5z1x B:301-495

Lineage for d5z1xb3 (5z1x B:301-495)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Cerrena sp. [TaxId:90311] [357121] (2 PDB entries)

8. Domain d5z1xb3: 5z1x B:301-495 [357134]
   automated match to d1gyca3
   complexed with cu, gol, nag, oxy, so4

Details for d5z1xb3

PDB Entry: 5z1x, 1.38 Å

PDB Description: crystal structure of laccase from cerrena sp. rsd1

PDB Compounds: (B:) laccase

SCOPe Domain Sequences for d5z1xb3:

Sequence; same for both SEQRES and ATOM records:

>d5z1xb3 b.6.1.0 (B:301-495) automated matches {Cerrena sp. [TaxId: 90311]}
qepnlrplvsmpvpgsatpggvdvvhnlilgfsagkftingaaftppsvpvllqilsgtt
naqdllpsgsvitlpigktieltlaagvlggphpfhlhghnfhvvrsagqttpnyvdpiv
rdvvntggtgdnvtirfttdnpgpwflhchidwhleagfavvfaegvnqtnaanptpadw
nnlcniynaladgdk

Timeline for d5z1xb3:

• d5z1xb3 first appeared in SCOPe 2.07