Lineage for d6fzxa_ (6fzx A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570210Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2570214Protein Elastase [63413] (1 species)
  7. 2570215Species Pseudomonas aeruginosa [TaxId:287] [55492] (6 PDB entries)
    Uniprot P14756 198-495
  8. 2570221Domain d6fzxa_: 6fzx A: [357131]
    automated match to d1u4ga_
    complexed with ca, eek, gol, so4, zn

Details for d6fzxa_

PDB Entry: 6fzx (more details), 2.1 Å

PDB Description: lasb, hydroxymate inhibitor complex
PDB Compounds: (A:) Keratinase KP2

SCOPe Domain Sequences for d6fzxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fzxa_ d.92.1.2 (A:) Elastase {Pseudomonas aeruginosa [TaxId: 287]}
aeaggpggnqkigkytygsdygplivndrcemddgnvitvdmnsstddskttpfrfacpt
ntykqvngaysplndahffggvvfklyrdwfgtsplthklymkvhygrsvenaywdgtam
lfgdgatmfyplvsldvaahevshgfteqnsgliyrgqsggmneafsdmageaaefymrg
kndfligydikkgsgalrymdqpsrdgrsidnasqyyngidvhhssgvynrafyllansp
gwdtrkafevfvdanryywtatsnynsgacgvirsaqnrnysaadvtrafstvgvtcp

SCOPe Domain Coordinates for d6fzxa_:

Click to download the PDB-style file with coordinates for d6fzxa_.
(The format of our PDB-style files is described here.)

Timeline for d6fzxa_: