Lineage for d1dp4a_ (1dp4 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2161445Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2161446Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2161447Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2161536Protein Hormone binding domain of the atrial natriuretic peptide receptor [53845] (2 species)
  7. 2161541Species Norway rat (Rattus norvegicus) [TaxId:10116] [53846] (3 PDB entries)
    Uniprot P18910 29-454
  8. 2161542Domain d1dp4a_: 1dp4 A: [35710]
    complexed with cl, nag, so4

Details for d1dp4a_

PDB Entry: 1dp4 (more details), 2 Å

PDB Description: dimerized hormone binding domain of the atrial natriuretic peptide receptor
PDB Compounds: (A:) Atrial natriuretic peptide receptor A

SCOPe Domain Sequences for d1dp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sdltvavvlpltntsypwswarvgpavelalarvkarpdllpgwtvrmvlgssenaagvc
sdtaaplaavdlkwehspavflgpgcvysaapvgrftahwrvplltagapalgigvkdey
alttrtgpshvklgdfvtalhrrlgwehqalvlyadrlgddrpcffiveglymrvrerln
itvnhqefvegdpdhypkllravrrkgrviyicsspdafrnlmllalnagltgedyvffh
ldvfgqslksaqglvpqkpwergdgqdrsarqafqaakiitykepdnpeyleflkqlkll
adkkfnftvedglkniipasfhdglllyvqavtetlaqggtvtdgenitqrmwnrsfqgv
tgylkidrngdrdtdfslwdmdpetgafrvvlnyngtsqelmavsehklywplgypppdv
pkcgf

SCOPe Domain Coordinates for d1dp4a_:

Click to download the PDB-style file with coordinates for d1dp4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dp4a_: