![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins) |
![]() | Protein Leucine-binding protein [53843] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53844] (1 PDB entry) |
![]() | Domain d2lbp__: 2lbp - [35709] |
PDB Entry: 2lbp (more details), 2.4 Å
SCOP Domain Sequences for d2lbp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lbp__ c.93.1.1 (-) Leucine-binding protein {Escherichia coli} ddikvavvgamsgpiaqwgimefngaeqaikdinakggikgdklvgveyddacdpkqava vankivndgikyvighlcssstqpasdiyedegilmispgatapeltqrgyqhimrtagl dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak
Timeline for d2lbp__: