SCOP 1.59: Domain d2lbp__: 2lbp -

Lineage for d2lbp__ (2lbp -)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)

6. Protein Leucine-binding protein [53843] (1 species)

7. Species Escherichia coli [TaxId:562] [53844] (1 PDB entry)

8. Domain d2lbp__: 2lbp - [35709]

Details for d2lbp__

PDB Entry: 2lbp, 2.4 Å

PDB Description: structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash)ile(slash)val-binding protein structure

SCOP Domain Sequences for d2lbp__:

Sequence; same for both SEQRES and ATOM records:

>d2lbp__ c.93.1.1 (-) Leucine-binding protein {Escherichia coli}
ddikvavvgamsgpiaqwgimefngaeqaikdinakggikgdklvgveyddacdpkqava
vankivndgikyvighlcssstqpasdiyedegilmispgatapeltqrgyqhimrtagl
dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak

Timeline for d2lbp__:

• d2lbp__ first appeared (with stable ids) in SCOP 1.55
  
• d2lbp__ appears in SCOP 1.57
  
• d2lbp__ appears in SCOP 1.61
  
• d2lbp__ appears in the current release, SCOPe 2.08, called d2lbpa_