Lineage for d2lbp__ (2lbp -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28093Protein Leucine-binding protein [53843] (1 species)
  7. 28094Species Escherichia coli [TaxId:562] [53844] (1 PDB entry)
  8. 28095Domain d2lbp__: 2lbp - [35709]

Details for d2lbp__

PDB Entry: 2lbp (more details), 2.4 Å

PDB Description: structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash)ile(slash)val-binding protein structure

SCOP Domain Sequences for d2lbp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lbp__ c.93.1.1 (-) Leucine-binding protein {Escherichia coli}
ddikvavvgamsgpiaqwgimefngaeqaikdinakggikgdklvgveyddacdpkqava
vankivndgikyvighlcssstqpasdiyedegilmispgatapeltqrgyqhimrtagl
dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak

SCOP Domain Coordinates for d2lbp__:

Click to download the PDB-style file with coordinates for d2lbp__.
(The format of our PDB-style files is described here.)

Timeline for d2lbp__: