Lineage for d6di3a_ (6di3 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. Domain d6di3a_: 6di3 A: [357088]
    automated match to d5p9ia_
    complexed with gja

Details for d6di3a_

PDB Entry: 6di3 (more details), 2 Å

PDB Description: crystal structure of btk in complex with fragment ligand
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d6di3a_:

Sequence, based on SEQRES records: (download)

>d6di3a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnl
sheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyl
eskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmys
kfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimys
cwhekaderptfkillsnildvmdees

Sequence, based on observed residues (ATOM records): (download)

>d6di3a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsweidpkdltflkelgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
kqflhrdlaarnclvndqgvvkvsdfglsryvlskfpvrwsppevlmyskfssksdiwaf
gvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscwhekaderpt
fkillsnildvmdees

SCOPe Domain Coordinates for d6di3a_ are not available.

Timeline for d6di3a_: