Lineage for d2liva_ (2liv A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520474Protein Leucine-,isoleucine-,valine-binding (LIV) protein [53841] (1 species)
  7. 2520475Species Escherichia coli [TaxId:562] [53842] (1 PDB entry)
  8. 2520476Domain d2liva_: 2liv A: [35708]

Details for d2liva_

PDB Entry: 2liv (more details), 2.4 Å

PDB Description: periplasmic binding protein structure and function. refined x-ray structures of the leucine/isoleucine/valine-binding protein and its complex with leucine
PDB Compounds: (A:) leucine

SCOPe Domain Sequences for d2liva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2liva_ c.93.1.1 (A:) Leucine-,isoleucine-,valine-binding (LIV) protein {Escherichia coli [TaxId: 562]}
edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqiakyddacdpkqava
vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak

SCOPe Domain Coordinates for d2liva_:

Click to download the PDB-style file with coordinates for d2liva_.
(The format of our PDB-style files is described here.)

Timeline for d2liva_: