Lineage for d2liv__ (2liv -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) 
Protein Leucine-,isoleucine-,valine-binding (LIV) protein [53841] (1 species) Species Escherichia coli [TaxId:562] [53842] (1 PDB entry) 
Domain d2liv__: 2liv - [35708]
Details for d2liv__
PDB Entry: 2liv (more details), 2.4 Å
PDB Description: periplasmic binding protein structure and function. refined x-ray structures of the leucine/isoleucine/valine-binding protein and its complex with leucine
SCOP Domain Sequences for d2liv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2liv__ c.93.1.1 (-) Leucine-,isoleucine-,valine-binding (LIV) protein {Escherichia coli}
edikvavvgamsgpvaqygdqeftgaeqavadinakggikgnklqiakyddacdpkqava
vankvvndgikyvighlcssstqpasdiyedegilmitpaatapeltargyqlilrttgl
dsdqgptaakyilekvkpqriaivhdkqqygeglaravqdglkkgnanvvffdgitagek
dfstlvarlkkenidfvyyggyhpemgqilrqaraaglktqfmgpegvanvslsniages
aegllvtkpknydqvpankpivdaikakkqdpsgafvwttyaalqslqaglnqsddpaei
akylkansvdtvmgpltwdekgdlkgfefgvfdwhangtatdak
SCOP Domain Coordinates for d2liv__:
Click to download the PDB-style file with coordinates for d2liv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2liv__:
- d2liv__ first appeared (with stable ids) in SCOP 1.55
- d2liv__ appears in SCOP 1.59
- d2liv__ appears in the current release, SCOPe 2.08, called d2liva_
View in 3D