Lineage for d1bykb_ (1byk B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250599Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 250600Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 250601Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 250724Protein Trehalose repressor, C-terminal domain [53839] (1 species)
  7. 250725Species Escherichia coli [TaxId:562] [53840] (1 PDB entry)
  8. 250727Domain d1bykb_: 1byk B: [35707]
    complexed with t6p

Details for d1bykb_

PDB Entry: 1byk (more details), 2.5 Å

PDB Description: trehalose repressor from escherichia coli

SCOP Domain Sequences for d1bykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bykb_ c.93.1.1 (B:) Trehalose repressor, C-terminal domain {Escherichia coli}
sdkvvaiivtrldslsenlavqtmlpafyeqgydpimmesqfspqlvaehlgvlkrrnid
gvvlfgftgiteemlahwqsslvllardakgfasvcyddegaikilmqrlydqghrnisy
lgvphsdvttgkrrheaylafckahklhpvaalpglamkqgyenvakvitpettallcat
dtlalgaskylqeqridtlqlasvgntplmkflhpeivtvdpgyaeagrqaacqliaqvt
grsepqqiiipatls

SCOP Domain Coordinates for d1bykb_:

Click to download the PDB-style file with coordinates for d1bykb_.
(The format of our PDB-style files is described here.)

Timeline for d1bykb_: