SCOPe 2.08: Domain d6fa2c1: 6fa2 C:1-167

Lineage for d6fa2c1 (6fa2 C:1-167)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6fa2c1: 6fa2 C:1-167 [357059]
   Other proteins in same PDB: d6fa2b2, d6fa2c2, d6fa2d2, d6fa2e2, d6fa2f2
   automated match to d3gfta_
   complexed with d2w, gnp, mg

Details for d6fa2c1

PDB Entry: 6fa2, 2.6 Å

PDB Description: antibody derived (abd-5) small molecule binding to kras.

PDB Compounds: (C:) GTPase KRas

SCOPe Domain Sequences for d6fa2c1:

Sequence, based on SEQRES records:

>d6fa2c1 c.37.1.8 (C:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d6fa2c1 c.37.1.8 (C:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptdsyrkqvvidgetclldildtagsa
mrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvd
tkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d6fa2c1:

• d6fa2c1 first appeared in SCOPe 2.07