Lineage for d6g5jb_ (6g5j B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2732922Protein Phospholipase A2 [48637] (5 species)
  7. 2732959Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (6 PDB entries)
    group X secretory phospholipase A2
  8. 2732970Domain d6g5jb_: 6g5j B: [357043]
    automated match to d1le6a_
    complexed with ca, dms, em8, peg

Details for d6g5jb_

PDB Entry: 6g5j (more details), 1.85 Å

PDB Description: secreted phospholipase a2 type x in complex with ligand
PDB Compounds: (B:) group 10 secretory phospholipase a2

SCOPe Domain Sequences for d6g5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g5jb_ a.133.1.2 (B:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kcd

SCOPe Domain Coordinates for d6g5jb_:

Click to download the PDB-style file with coordinates for d6g5jb_.
(The format of our PDB-style files is described here.)

Timeline for d6g5jb_: