Lineage for d1lbgc2 (1lbg C:61-357)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494585Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 494586Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 494587Family c.93.1.1: L-arabinose binding protein-like [53823] (14 proteins)
  6. 494645Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 494646Species Escherichia coli [TaxId:562] [53838] (8 PDB entries)
  8. 494669Domain d1lbgc2: 1lbg C:61-357 [35704]
    Other proteins in same PDB: d1lbga1, d1lbgb1, d1lbgc1, d1lbgd1

Details for d1lbgc2

PDB Entry: 1lbg (more details), 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

SCOP Domain Sequences for d1lbgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbgc2 c.93.1.1 (C:61-357) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOP Domain Coordinates for d1lbgc2:

Click to download the PDB-style file with coordinates for d1lbgc2.
(The format of our PDB-style files is described here.)

Timeline for d1lbgc2: