Lineage for d1lbgc2 (1lbg C:61-357)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75160Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 75161Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 75162Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 75211Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 75212Species Escherichia coli [TaxId:562] [53838] (5 PDB entries)
  8. 75230Domain d1lbgc2: 1lbg C:61-357 [35704]
    Other proteins in same PDB: d1lbga1, d1lbgb1, d1lbgc1, d1lbgd1

Details for d1lbgc2

PDB Entry: 1lbg (more details), 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

SCOP Domain Sequences for d1lbgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbgc2 c.93.1.1 (C:61-357) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOP Domain Coordinates for d1lbgc2:

Click to download the PDB-style file with coordinates for d1lbgc2.
(The format of our PDB-style files is described here.)

Timeline for d1lbgc2: