![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (37 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
![]() | Domain d6fa2e1: 6fa2 E:1-167 [357035] Other proteins in same PDB: d6fa2b2, d6fa2c2, d6fa2d2, d6fa2e2, d6fa2f2 automated match to d3gfta_ complexed with d2w, gnp, mg |
PDB Entry: 6fa2 (more details), 2.6 Å
SCOPe Domain Sequences for d6fa2e1:
Sequence, based on SEQRES records: (download)
>d6fa2e1 c.37.1.8 (E:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
>d6fa2e1 c.37.1.8 (E:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag mrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvd tkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
Timeline for d6fa2e1: