Lineage for d6fa2d1 (6fa2 D:1-167)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476240Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)
  8. 2476734Domain d6fa2d1: 6fa2 D:1-167 [357032]
    Other proteins in same PDB: d6fa2b2, d6fa2c2, d6fa2d2, d6fa2e2, d6fa2f2
    automated match to d3gfta_
    complexed with d2w, gnp, mg

Details for d6fa2d1

PDB Entry: 6fa2 (more details), 2.6 Å

PDB Description: antibody derived (abd-5) small molecule binding to kras.
PDB Compounds: (D:) GTPase KRas

SCOPe Domain Sequences for d6fa2d1:

Sequence, based on SEQRES records: (download)

>d6fa2d1 c.37.1.8 (D:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records): (download)

>d6fa2d1 c.37.1.8 (D:1-167) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydsyrkqvvidgetclldildtagrdqym
rtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkqaqd
larsygipfietsaktrqgvddafytlvreirkhk

SCOPe Domain Coordinates for d6fa2d1:

Click to download the PDB-style file with coordinates for d6fa2d1.
(The format of our PDB-style files is described here.)

Timeline for d6fa2d1: