![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
![]() | Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53838] (11 PDB entries) |
![]() | Domain d1lbgb2: 1lbg B:61-357 [35703] Other proteins in same PDB: d1lbga1, d1lbgb1, d1lbgc1, d1lbgd1 protein/DNA complex |
PDB Entry: 1lbg (more details), 4.8 Å
SCOPe Domain Sequences for d1lbgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbgb2 c.93.1.1 (B:61-357) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
Timeline for d1lbgb2: