Lineage for d6adia1 (6adi A:41-452)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513401Protein automated matches [190072] (22 species)
    not a true protein
  7. 2513473Species Human (Homo sapiens) [TaxId:9606] [189131] (10 PDB entries)
  8. 2513483Domain d6adia1: 6adi A:41-452 [357027]
    Other proteins in same PDB: d6adia2
    automated match to d1lwda_
    complexed with 9uo, ndp

Details for d6adia1

PDB Entry: 6adi (more details), 1.97 Å

PDB Description: crystal structures of idh2 r140q in complex with ag-881
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d6adia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6adia1 c.77.1.1 (A:41-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrq

SCOPe Domain Coordinates for d6adia1:

Click to download the PDB-style file with coordinates for d6adia1.
(The format of our PDB-style files is described here.)

Timeline for d6adia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6adia2
View in 3D
Domains from other chains:
(mouse over for more information)
d6adib_