SCOPe 2.07: Domain d6adia1: 6adi A:41-452

Lineage for d6adia1 (6adi A:41-452)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189131] (10 PDB entries)

8. Domain d6adia1: 6adi A:41-452 [357027]
   Other proteins in same PDB: d6adia2
   automated match to d1lwda_
   complexed with 9uo, ndp

Details for d6adia1

PDB Entry: 6adi, 1.97 Å

PDB Description: crystal structures of idh2 r140q in complex with ag-881

PDB Compounds: (A:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d6adia1:

Sequence; same for both SEQRES and ATOM records:

>d6adia1 c.77.1.1 (A:41-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrq

Timeline for d6adia1:

• d6adia1 is new in SCOPe 2.07-stable
  
• d6adia1 appears in the current release, SCOPe 2.08