Lineage for d6dama_ (6dam A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2809844Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2809845Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 2809933Family b.70.1.0: automated matches [227985] (1 protein)
    not a true family
  6. 2809934Protein automated matches [227986] (6 species)
    not a true protein
  7. 2809945Species Methylomicrobium buryatense [TaxId:675511] [357025] (1 PDB entry)
  8. 2809946Domain d6dama_: 6dam A: [357026]
    automated match to d2ad6a_
    complexed with la, na, pqq

Details for d6dama_

PDB Entry: 6dam (more details), 1.85 Å

PDB Description: crystal structure of lanthanide-dependent methanol dehydrogenase xoxf from methylomicrobium buryatense 5g
PDB Compounds: (A:) Lanthanide-dependent methanol dehydrogenase XoxF

SCOPe Domain Sequences for d6dama_:

Sequence, based on SEQRES records: (download)

>d6dama_ b.70.1.0 (A:) automated matches {Methylomicrobium buryatense [TaxId: 675511]}
nsevekltknpanwatwggnyhgtryselkqintsnvknlqpawtfstgvlrgheggplv
vndvmyihtpfpntvyaidqktqaviweytpqqdadvtipvmccdtvnrglaygdgkifl
qqsdtvltaldaktgkrvwsvqngdpklgmtntqaplvvkdkvitgisggefgvrgflaa
ynirtgeldwkgysmgpdadtlinptktttwkdgkvqpvgkdsststwegdqwkigggtt
wgwysydpelnlvyygsgnpstwnpaqrpgdnkwsmslwarnadtgevkwvyqmtphdew
dydginevalvdqeikgqmrktavhfdrngfgytldrvtgellvaekfdkavnwashvdm
ksgrpqvvsqysteyngedvntegvcpaalgsknqqpvsyspqtgyfyisgnhvcmdyep
feveytagqpyvgatlsmfpagkdvitgkedgsnnlgqftawdattgkiiwsnkeqfsvw
sgslataggvvfygtlegylkavdaktgkelyrfktpsgiignvntweyegkqyvgvlsg
vggwagigiaagldsgeessnseglgavgayrslssytklggtltvfalpn

Sequence, based on observed residues (ATOM records): (download)

>d6dama_ b.70.1.0 (A:) automated matches {Methylomicrobium buryatense [TaxId: 675511]}
nsevekltknpanwatwggnyhgtryselkqintsnvknlqpawtfstgvlrgheggplv
vndvmyihtpfpntvyaidqktqaviweytpqqdadvtipvmccdtvnrglaygdgkifl
qqsdtvltaldaktgkrvwsvqngdpklgmtntqaplvvkdkvitgisggefgvrgflaa
ynirtgeldwkgysmgpdadtlinptktttwkdgkvqpvgkdsststwegdqwkigggtt
wgwysydpelnlvyygsgnpstwnpaqrpgdnkwsmslwarnadtgevkwvyqmtphdew
dydginevalvdqeikgqmrktavhfdrngfgytldrvtgellvaekfdkavnwashvdm
ksgrpqvvsqysteyngedvntegvcpaalgsknqqpvsyspqtgyfyisgnhvcmdyep
feveytagqpyvgatlsmfpagkdvitgkedgsnnlgqftawdattgkiiwsnkeqfsvw
sgslataggvvfygtlegylkavdaktgkelyrfktpsgiignvntweyegkqyvgvlsg
vggwslssytklggtltvfalpn

SCOPe Domain Coordinates for d6dama_:

Click to download the PDB-style file with coordinates for d6dama_.
(The format of our PDB-style files is described here.)

Timeline for d6dama_: