Lineage for d6edxa_ (6edx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005656Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 3005657Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 3005658Family d.189.1.1: PX domain [64269] (6 proteins)
    Pfam PF00787
  6. 3005682Protein automated matches [357022] (1 species)
    not a true protein
  7. 3005683Species Human (Homo sapiens) [TaxId:9606] [357023] (1 PDB entry)
  8. 3005684Domain d6edxa_: 6edx A: [357024]
    automated match to d1xtea_
    complexed with gol

Details for d6edxa_

PDB Entry: 6edx (more details), 2.01 Å

PDB Description: crystal structure of sgk3 px domain
PDB Compounds: (A:) Serine/threonine-protein kinase Sgk3

SCOPe Domain Sequences for d6edxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6edxa_ d.189.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scpsvsipssdehrekkkrftvykvlvsvgrsewfvfrryaefdklyntlkkqfpamalk
ipakrifgdnfdpdfikqrraglnefiqnlvrypelynhpdvraflqmdspkhq

SCOPe Domain Coordinates for d6edxa_:

Click to download the PDB-style file with coordinates for d6edxa_.
(The format of our PDB-style files is described here.)

Timeline for d6edxa_: