Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.189: PX domain [64267] (1 superfamily) beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch |
Superfamily d.189.1: PX domain [64268] (2 families) |
Family d.189.1.1: PX domain [64269] (6 proteins) Pfam PF00787 |
Protein automated matches [357022] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [357023] (1 PDB entry) |
Domain d6edxa_: 6edx A: [357024] automated match to d1xtea_ complexed with gol |
PDB Entry: 6edx (more details), 2.01 Å
SCOPe Domain Sequences for d6edxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6edxa_ d.189.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} scpsvsipssdehrekkkrftvykvlvsvgrsewfvfrryaefdklyntlkkqfpamalk ipakrifgdnfdpdfikqrraglnefiqnlvrypelynhpdvraflqmdspkhq
Timeline for d6edxa_: