Lineage for d1lbhd_ (1lbh D:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins) 
Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) Species Escherichia coli [TaxId:562] [53838] (5 PDB entries) 
Domain d1lbhd_: 1lbh D: [35701]
Details for d1lbhd_
PDB Entry: 1lbh (more details), 3.2 Å
PDB Description: intact lactose operon repressor with gratuitous inducer iptg
SCOP Domain Sequences for d1lbhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbhd_ c.93.1.1 (D:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
SCOP Domain Coordinates for d1lbhd_:
Click to download the PDB-style file with coordinates for d1lbhd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lbhd_:
- d1lbhd_ appears in SCOP 1.57
- d1lbhd_ appears in the current release, SCOPe 2.08
View in 3D
