SCOPe 2.07: Domain d6d9ib_: 6d9i B:

Lineage for d6d9ib_ (6d9i B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (8 species)
   not a true protein

7. Species Duck (Anas platyrhynchos) [TaxId:8839] [341650] (7 PDB entries)

8. Domain d6d9ib_: 6d9i B: [357006]
   automated match to d5v92a_
   complexed with cl, mg

Details for d6d9ib_

PDB Entry: 6d9i, 1.15 Å

PDB Description: pekin duck egg lysozyme isoform ii (del-ii)

PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d6d9ib_:

Sequence; same for both SEQRES and ATOM records:

>d6d9ib_ d.2.1.2 (B:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
rwwcddgktprsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
skwirgcrl

Timeline for d6d9ib_:

• d6d9ib_ is new in SCOPe 2.07-stable
  
• d6d9ib_ appears in the current release, SCOPe 2.08