Lineage for d6d9ib_ (6d9i B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. Protein automated matches [190299] (8 species)
    not a true protein
  7. Species Duck (Anas platyrhynchos) [TaxId:8839] [341650] (7 PDB entries)
  8. Domain d6d9ib_: 6d9i B: [357006]
    automated match to d5v92a_
    complexed with cl, mg

Details for d6d9ib_

PDB Entry: 6d9i (more details), 1.1500000000000001 Å

PDB Description: pekin duck egg lysozyme isoform ii (del-ii)
PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d6d9ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d9ib_ d.2.1.2 (B:) automated matches {Duck (Anas platyrhynchos) [TaxId: 8839]}
kvysrcelaaamkrlgldnyrgyslgnwvcaanyesgfntqatnrntdgstdygilqins
rwwcddgktprsknacgipcsvllrsditeavrcakrivsdgngmnawvawrnrcrgtdv
skwirgcrl

SCOPe Domain Coordinates for d6d9ib_ are not available.

Timeline for d6d9ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6d9ia_