| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) ![]() Similar in architecture to the superfamily II but partly differs in topology |
| Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins) |
| Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
| Species Escherichia coli [TaxId:562] [53838] (8 PDB entries) |
| Domain d1lbhb_: 1lbh B: [35699] |
PDB Entry: 1lbh (more details), 3.2 Å
SCOP Domain Sequences for d1lbhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lbhb_ c.93.1.1 (B:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle
Timeline for d1lbhb_: