Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) automatically mapped to Pfam PF03951 |
Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
Protein automated matches [226862] (5 species) not a true protein |
Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries) |
Domain d5zlpf1: 5zlp F:7-110 [356982] Other proteins in same PDB: d5zlpa2, d5zlpb2, d5zlpc2, d5zlpd2, d5zlpe2, d5zlpf2, d5zlpg2, d5zlph2, d5zlpi2, d5zlpj2, d5zlpk2, d5zlpl2 automated match to d1htoa1 complexed with adp, atp, mg, p3p, ppq |
PDB Entry: 5zlp (more details), 2.93 Å
SCOPe Domain Sequences for d5zlpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zlpf1 d.15.9.0 (F:7-110) automated matches {Helicobacter pylori [TaxId: 85962]} nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy
Timeline for d5zlpf1: