Lineage for d1lbha_ (1lbh A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127989Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 127990Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 127991Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 128040Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 128041Species Escherichia coli [TaxId:562] [53838] (8 PDB entries)
  8. 128055Domain d1lbha_: 1lbh A: [35698]

Details for d1lbha_

PDB Entry: 1lbh (more details), 3.2 Å

PDB Description: intact lactose operon repressor with gratuitous inducer iptg

SCOP Domain Sequences for d1lbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbha_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOP Domain Coordinates for d1lbha_:

Click to download the PDB-style file with coordinates for d1lbha_.
(The format of our PDB-style files is described here.)

Timeline for d1lbha_: