SCOPe 2.07: Domain d6gzhb1: 6gzh B:8-150

Lineage for d6gzhb1 (6gzh B:8-150)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.0: automated matches [227298] (1 protein)
   not a true family

6. Protein automated matches [227124] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries)

8. Domain d6gzhb1: 6gzh B:8-150 [356978]
   Other proteins in same PDB: d6gzha_
   automated match to d2pk2a2
   complexed with gol, lci

Details for d6gzhb1

PDB Entry: 6gzh, 3.17 Å

PDB Description: crystal structure of human cdk9/cyclint1 with a86

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d6gzhb1:

Sequence; same for both SEQRES and ATOM records:

>d6gzhb1 a.74.1.0 (B:8-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
rfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseayl
qqvqdlvilesiilqtlgfelti

Timeline for d6gzhb1:

• d6gzhb1 is new in SCOPe 2.07-stable
  
• d6gzhb1 appears in the current release, SCOPe 2.08