Lineage for d6efgb3 (6efg B:361-563)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473412Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2473413Protein automated matches [227126] (21 species)
    not a true protein
  7. 2473543Species Kluyveromyces lactis [TaxId:284590] [356722] (2 PDB entries)
  8. 2473547Domain d6efgb3: 6efg B:361-563 [356969]
    Other proteins in same PDB: d6efga2, d6efgb2, d6efgd2, d6efge2
    automated match to d2g1ia3
    complexed with mg, tpp

Details for d6efgb3

PDB Entry: 6efg (more details), 2.04 Å

PDB Description: pyruvate decarboxylase from kluyveromyces lactis
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d6efgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6efgb3 c.36.1.0 (B:361-563) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
ptmdapsnlvkqaqltaatnakn

SCOPe Domain Coordinates for d6efgb3:

Click to download the PDB-style file with coordinates for d6efgb3.
(The format of our PDB-style files is described here.)

Timeline for d6efgb3: