Lineage for d6efgb2 (6efg B:182-360)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471274Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2471275Protein automated matches [190312] (14 species)
    not a true protein
  7. 2471338Species Kluyveromyces lactis [TaxId:284590] [356724] (2 PDB entries)
  8. 2471340Domain d6efgb2: 6efg B:182-360 [356968]
    Other proteins in same PDB: d6efga1, d6efga3, d6efgb1, d6efgb3, d6efgd1, d6efgd3, d6efge1, d6efge3
    automated match to d2vk4a2
    complexed with mg, tpp

Details for d6efgb2

PDB Entry: 6efg (more details), 2.04 Å

PDB Description: pyruvate decarboxylase from kluyveromyces lactis
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d6efgb2:

Sequence, based on SEQRES records: (download)

>d6efgb2 c.31.1.0 (B:182-360) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp
afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy
ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava

Sequence, based on observed residues (ATOM records): (download)

>d6efgb2 c.31.1.0 (B:182-360) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp
afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgalnivefhsdytkir
satfpgvqmkfalqklltkvadaakgykpvpvpsepehneava

SCOPe Domain Coordinates for d6efgb2:

Click to download the PDB-style file with coordinates for d6efgb2.
(The format of our PDB-style files is described here.)

Timeline for d6efgb2: