SCOPe 2.08: Domain d6efgb2: 6efg B:182-360

Lineage for d6efgb2 (6efg B:182-360)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Kluyveromyces lactis [TaxId:284590] [356724] (2 PDB entries)

8. Domain d6efgb2: 6efg B:182-360 [356968]
   Other proteins in same PDB: d6efga1, d6efga3, d6efgb1, d6efgb3, d6efgd1, d6efgd3, d6efge1, d6efge3
   automated match to d2vk4a2
   complexed with mg, tpp

Details for d6efgb2

PDB Entry: 6efg, 2.04 Å

PDB Description: pyruvate decarboxylase from kluyveromyces lactis

PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d6efgb2:

Sequence, based on SEQRES records:

>d6efgb2 c.31.1.0 (B:182-360) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp
afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy
ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava

Sequence, based on observed residues (ATOM records):

>d6efgb2 c.31.1.0 (B:182-360) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp
afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgalnivefhsdytkir
satfpgvqmkfalqklltkvadaakgykpvpvpsepehneava

Timeline for d6efgb2:

• d6efgb2 first appeared in SCOPe 2.07