Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein Clp protease, ClpP subunit [52098] (11 species) |
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [141995] (4 PDB entries) Uniprot Q16740 57-249 |
Domain d6h23f_: 6h23 F: [356966] automated match to d1tg6e_ complexed with edo, fjt; mutant |
PDB Entry: 6h23 (more details), 3.09 Å
SCOPe Domain Sequences for d6h23f_:
Sequence, based on SEQRES records: (download)
>d6h23f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} diysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglaiy dtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpsggargqatdiai qaeeimklkkqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
>d6h23f_ c.14.1.1 (F:) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} diysrllrerivcvmgpiddsvaslviaqllflqsesnkkpihmainspggvvtaglaiy dtmqyilnpictwcvgqaasmgslllaagtpgmrhslpnsrimihqpdiaiqaeeimklk kqlyniyakhtkqslqviesamerdrymspmeaqefgildkvlvhp
Timeline for d6h23f_: