Lineage for d6gzha_ (6gzh A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein automated matches [190091] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188447] (844 PDB entries)
  8. Domain d6gzha_: 6gzh A: [356964]
    Other proteins in same PDB: d6gzhb1, d6gzhb2
    automated match to d4bcia_
    complexed with gol, lci

Details for d6gzha_

PDB Entry: 6gzh (more details), 3.17 Å

PDB Description: crystal structure of human cdk9/cyclint1 with a86
PDB Compounds: (A:) Cyclin-dependent kinase 9

SCOPe Domain Sequences for d6gzha_:

Sequence, based on SEQRES records: (download)

>d6gzha_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlkg

Sequence, based on observed residues (ATOM records): (download)

>d6gzha_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkasgsiylvfdfcehdlagllsnvlvkftlseikrvmqml
lnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaqpnrytnrvvtlwyrp
pelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnv
dnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffw
sdpmpsdlkg

SCOPe Domain Coordinates for d6gzha_ are not available.

Timeline for d6gzha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6gzhb1, d6gzhb2