SCOPe 2.07: Domain d5zlpg1: 5zlp G:6-110

Lineage for d5zlpg1 (5zlp G:6-110)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries)

8. Domain d5zlpg1: 5zlp G:6-110 [356962]
   Other proteins in same PDB: d5zlpa2, d5zlpb2, d5zlpc2, d5zlpd2, d5zlpe2, d5zlpf2, d5zlpg2, d5zlph2, d5zlpi2, d5zlpj2, d5zlpk2, d5zlpl2
   automated match to d1htoa1
   complexed with adp, atp, mg, p3p, ppq

Details for d5zlpg1

PDB Entry: 5zlp, 2.93 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori

PDB Compounds: (G:) glutamine synthetase

SCOPe Domain Sequences for d5zlpg1:

Sequence; same for both SEQRES and ATOM records:

>d5zlpg1 d.15.9.0 (G:6-110) automated matches {Helicobacter pylori [TaxId: 85962]}
qnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfk
gwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy

Timeline for d5zlpg1:

• d5zlpg1 is new in SCOPe 2.07-stable