![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
![]() | Protein automated matches [190312] (14 species) not a true protein |
![]() | Species Kluyveromyces lactis [TaxId:284590] [356724] (2 PDB entries) |
![]() | Domain d6efge2: 6efg E:182-360 [356956] Other proteins in same PDB: d6efga1, d6efga3, d6efgb1, d6efgb3, d6efgd1, d6efgd3, d6efge1, d6efge3 automated match to d2vk4a2 complexed with mg, tpp |
PDB Entry: 6efg (more details), 2.04 Å
SCOPe Domain Sequences for d6efge2:
Sequence, based on SEQRES records: (download)
>d6efge2 c.31.1.0 (E:182-360) automated matches {Kluyveromyces lactis [TaxId: 284590]} dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
>d6efge2 c.31.1.0 (E:182-360) automated matches {Kluyveromyces lactis [TaxId: 284590]} dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallyktknivefhsd ytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
Timeline for d6efge2: