Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Kluyveromyces lactis [TaxId:284590] [356722] (2 PDB entries) |
Domain d6efgd1: 6efg D:2-181 [356950] Other proteins in same PDB: d6efga2, d6efgb2, d6efgd2, d6efge2 automated match to d2vk4a1 complexed with mg, tpp |
PDB Entry: 6efg (more details), 2.04 Å
SCOPe Domain Sequences for d6efgd1:
Sequence, based on SEQRES records: (download)
>d6efgd1 c.36.1.0 (D:2-181) automated matches {Kluyveromyces lactis [TaxId: 284590]} seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvssqakqlllhhtlgngd ftvfhrmssnisettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll
>d6efgd1 c.36.1.0 (D:2-181) automated matches {Kluyveromyces lactis [TaxId: 284590]} seitlgrylferlkqvevqtifglpgdfnlslldniyevpgmrwagnanelnaayaadgy arlkgmsciittfgvgelsalngiagsyaehvgvlhvvgvpsvhtlgngdftvfhrmssn isettamitdintapaeidrcirttyvsqrpvylglpanlvdltvpasll
Timeline for d6efgd1: