Lineage for d1lbib_ (1lbi B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390243Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1390244Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1390245Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1390348Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 1390349Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 1390362Domain d1lbib_: 1lbi B: [35695]

Details for d1lbib_

PDB Entry: 1lbi (more details), 2.7 Å

PDB Description: lac repressor
PDB Compounds: (B:) lac repressor

SCOPe Domain Sequences for d1lbib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbib_ c.93.1.1 (B:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOPe Domain Coordinates for d1lbib_:

Click to download the PDB-style file with coordinates for d1lbib_.
(The format of our PDB-style files is described here.)

Timeline for d1lbib_: