SCOPe 2.07: Domain d5y7na_: 5y7n A:

Lineage for d5y7na_ (5y7n A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51437] (155 PDB entries)
   Uniprot P15121

8. Domain d5y7na_: 5y7n A: [356946]
   automated match to d4wevx_
   complexed with 8ql, nap

Details for d5y7na_

PDB Entry: 5y7n, 2.5 Å

PDB Description: crystal structure of akr1b10 in complex with nadp+ and androst-4-ene- 3-beta-6-alpha-diol

PDB Compounds: (A:) Aldo-keto reductase family 1 member B10

SCOPe Domain Sequences for d5y7na_:

Sequence; same for both SEQRES and ATOM records:

>d5y7na_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
fvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiqeki
qekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgddlf
pkddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykpvtn
qvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaakhkk
taaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracnvlq
sshledypfnaey

Timeline for d5y7na_:

• d5y7na_ is new in SCOPe 2.07-stable
  
• d5y7na_ appears in the current release, SCOPe 2.08