![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
![]() | Protein automated matches [226862] (5 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries) |
![]() | Domain d5zlic1: 5zli C:8-110 [356940] Other proteins in same PDB: d5zlia2, d5zlib2, d5zlic2, d5zlid2, d5zlie2, d5zlif2 automated match to d1htoa1 |
PDB Entry: 5zli (more details), 2.8 Å
SCOPe Domain Sequences for d5zlic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zlic1 d.15.9.0 (C:8-110) automated matches {Helicobacter pylori [TaxId: 85962]} seskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgw qgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy
Timeline for d5zlic1: