SCOPe 2.07: Domain d5opdb3: 5opd B:298-393

Lineage for d5opdb3 (5opd B:298-393)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.0: automated matches [254194] (1 protein)
   not a true family

6. Protein automated matches [254425] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:331112] [343073] (2 PDB entries)

8. Domain d5opdb3: 5opd B:298-393 [356932]
   Other proteins in same PDB: d5opda1, d5opda2, d5opdb1, d5opdb2
   automated match to d1d8ta2
   complexed with gol, gtp, iod, mg, na

Details for d5opdb3

PDB Entry: 5opd, 2.75 Å

PDB Description: structure of phosphorylated ef-tu in complex with gtp

PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d5opdb3:

Sequence; same for both SEQRES and ATOM records:

>d5opdb3 b.44.1.0 (B:298-393) automated matches {Escherichia coli [TaxId: 331112]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvl

Timeline for d5opdb3:

• d5opdb3 is new in SCOPe 2.07-stable
  
• d5opdb3 appears in the current release, SCOPe 2.08