Lineage for d1efac2 (1efa C:61-331)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186118Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 186119Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 186120Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 186169Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 186170Species Escherichia coli [TaxId:562] [53838] (8 PDB entries)
  8. 186178Domain d1efac2: 1efa C:61-331 [35693]
    Other proteins in same PDB: d1efaa1, d1efab1, d1efac1

Details for d1efac2

PDB Entry: 1efa (more details), 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf

SCOP Domain Sequences for d1efac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efac2 c.93.1.1 (C:61-331) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttla

SCOP Domain Coordinates for d1efac2:

Click to download the PDB-style file with coordinates for d1efac2.
(The format of our PDB-style files is described here.)

Timeline for d1efac2: