![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
![]() | Protein automated matches [226862] (5 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries) |
![]() | Domain d5zlpl1: 5zlp L:6-110 [356924] Other proteins in same PDB: d5zlpa2, d5zlpb2, d5zlpc2, d5zlpd2, d5zlpe2, d5zlpf2, d5zlpg2, d5zlph2, d5zlpi2, d5zlpj2, d5zlpk2, d5zlpl2 automated match to d1htoa1 complexed with adp, atp, mg, p3p, ppq |
PDB Entry: 5zlp (more details), 2.93 Å
SCOPe Domain Sequences for d5zlpl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zlpl1 d.15.9.0 (L:6-110) automated matches {Helicobacter pylori [TaxId: 85962]} qnseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfk gwqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy
Timeline for d5zlpl1: