SCOPe 2.08: Domain d6fipa1: 6fip A:247-342

Lineage for d6fipa1 (6fip A:247-342)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
   beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer

4. Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families)

5. Family d.212.1.0: automated matches [356919] (1 protein)
   not a true family

6. Protein automated matches [356920] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [356921] (1 PDB entry)

8. Domain d6fipa1: 6fip A:247-342 [356922]
   Other proteins in same PDB: d6fipa2
   automated match to d1xx3a_

Details for d6fipa1

PDB Entry: 6fip

PDB Description: solution nmr structure of pseudomonas aeruginosa tonb ctd

PDB Compounds: (A:) Protein tonB

SCOPe Domain Sequences for d6fipa1:

Sequence; same for both SEQRES and ATOM records:

>d6fipa1 d.212.1.0 (A:247-342) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gslndsdikplrmdppvyprmaqargiegrvkvlftitsdgriddiqvlesvpsrmfdre
vrqamakwrfeprvsggkivarqatkmfffkiekrr

Timeline for d6fipa1:

• d6fipa1 first appeared in SCOPe 2.07