Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins) |
Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
Species Escherichia coli [TaxId:562] [53838] (8 PDB entries) |
Domain d1efab2: 1efa B:61-331 [35692] Other proteins in same PDB: d1efaa1, d1efab1, d1efac1 |
PDB Entry: 1efa (more details), 2.6 Å
SCOP Domain Sequences for d1efab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efab2 c.93.1.1 (B:61-331) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli} slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts vdrllqlsqgqavkgnqllpvslvkrkttla
Timeline for d1efab2:
View in 3D Domains from other chains: (mouse over for more information) d1efaa1, d1efaa2, d1efac1, d1efac2 |