SCOP 1.61: Domain d1efab2: 1efa B:61-331

Lineage for d1efab2 (1efa B:61-331)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (8 PDB entries)

8. Domain d1efab2: 1efa B:61-331 [35692]
   Other proteins in same PDB: d1efaa1, d1efab1, d1efac1

Details for d1efab2

PDB Entry: 1efa, 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf

SCOP Domain Sequences for d1efab2:

Sequence; same for both SEQRES and ATOM records:

>d1efab2 c.93.1.1 (B:61-331) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttla

Timeline for d1efab2:

• d1efab2 first appeared (with stable ids) in SCOP 1.55
  
• d1efab2 appears in SCOP 1.59
  
• d1efab2 appears in SCOP 1.63
  
• d1efab2 appears in the current release, SCOPe 2.08