Lineage for d1tlfd_ (1tlf D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28022Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 28023Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 28024Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)
  6. 28069Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 28070Species Escherichia coli [TaxId:562] [53838] (5 PDB entries)
  8. 28074Domain d1tlfd_: 1tlf D: [35690]

Details for d1tlfd_

PDB Entry: 1tlf (more details), 2.6 Å

PDB Description: unprecedented quaternary structure of e. coli lac repressor core tetramer: implications for dna looping

SCOP Domain Sequences for d1tlfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlfd_ c.93.1.1 (D:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl

SCOP Domain Coordinates for d1tlfd_:

Click to download the PDB-style file with coordinates for d1tlfd_.
(The format of our PDB-style files is described here.)

Timeline for d1tlfd_: