Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Striga hermonthica [TaxId:68872] [278337] (16 PDB entries) |
Domain d5z7wa_: 5z7w A: [356891] Other proteins in same PDB: d5z7wb2 automated match to d5cbka_ complexed with gol, mg, na |
PDB Entry: 5z7w (more details), 1.66 Å
SCOPe Domain Sequences for d5z7wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z7wa_ c.69.1.0 (A:) automated matches {Striga hermonthica [TaxId: 68872]} glaqeahnvrvlgsgpqtvvlahgfgtdqsvwkylvphlvedyrvvlfdimgagttnpty fnferysslegyagdviaileelqisscvyvghsvsamigviasvtrpdlftklvtvags prylndpdyfggfdldelhelfeamkenykawcsgfaplcvgadmeslavqefsrtlfnm rpdialsilqtifysdvrpllphvtvpchiiqsvkdlavpvavseyihqslggesilevm ateghlpqlsspdvvvpvllrhiryaiar
Timeline for d5z7wa_: