SCOPe 2.08: Domain d5z7xa1: 5z7x A:1-269

Lineage for d5z7xa1 (5z7x A:1-269)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Striga hermonthica [TaxId:68872] [278337] (16 PDB entries)

8. Domain d5z7xa1: 5z7x A:1-269 [356888]
   Other proteins in same PDB: d5z7xa2
   automated match to d5cbka_
   complexed with edo, mg

Details for d5z7xa1

PDB Entry: 5z7x, 2.06 Å

PDB Description: crystal structure of striga hermonthica htl4 (shhtl4)

PDB Compounds: (A:) Hyposensitive to light 4

SCOPe Domain Sequences for d5z7xa1:

Sequence; same for both SEQRES and ATOM records:

>d5z7xa1 c.69.1.0 (A:1-269) automated matches {Striga hermonthica [TaxId: 68872]}
mstvgsahnvrvlgsgettvvlghgfgtdqsvwkqlvpyltdeyrvllydnmgagttnpd
cydferyssleghsndliailddfhvtkciyvghslssmaaavssifrpdlfrkvvmisa
tpritntedyyggfeqeeinqmntameenfktmmmgfapivvggdlesdaiqefsrtlfn
mrpdialsicrmisgldlrpylglivvpchiiqsskdmlvpvavaeylhknlggksvvel
ipteghlphlsapeltipvlvrhikhdia

Timeline for d5z7xa1:

• d5z7xa1 first appeared in SCOPe 2.07