Lineage for d6ezza4 (6ezz A:301-724)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391116Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2391117Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2391254Protein automated matches [356739] (2 species)
    not a true protein
  7. 2391258Species Escherichia coli [TaxId:83333] [356740] (1 PDB entry)
  8. 2391259Domain d6ezza4: 6ezz A:301-724 [356884]
    Other proteins in same PDB: d6ezza1, d6ezza2, d6ezza3, d6ezzb1, d6ezzb2, d6ezzb3
    automated match to d1oaca1
    complexed with ca, cu, gol; mutant

Details for d6ezza4

PDB Entry: 6ezz (more details), 1.8 Å

PDB Description: crystal structure of escherichia coli amine oxidase mutant e573q
PDB Compounds: (A:) primary amine oxidase

SCOPe Domain Sequences for d6ezza4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ezza4 b.30.2.1 (A:301-724) automated matches {Escherichia coli [TaxId: 83333]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmistvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynignqqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galk

SCOPe Domain Coordinates for d6ezza4:

Click to download the PDB-style file with coordinates for d6ezza4.
(The format of our PDB-style files is described here.)

Timeline for d6ezza4: